DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psma1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_058974.1 Gene:Psma1 / 29668 RGDID:61841 Length:263 Species:Rattus norvegicus


Alignment Length:253 Identity:85/253 - (33%)
Similarity:140/253 - (55%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            ::||..||::||.|.:.|:|||.|||::||..||::.....||...|::.::|...:|  ||..:
  Rat     4 NQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK--KILHV 66

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS 132
            |||:.::.||||||||::.|..:.||...|...:.|:.:..:...|....|..||..||||:|:.
  Rat    67 DNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVG 131

  Fly   133 CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRAL 197
            .||.|:| |...|:|||.||..:::.:|.:.|..::..|.:.|:...|....|....||..:|||
  Rat   132 LLIAGYD-DMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMQCNLDELVKHGLRAL 195

  Fly   198 LEVAQSGQN----NLEVAIMENGKPLK--MLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            .|...:.|:    |:.:.|:  ||.|:  :.|.|.::.::        :.||::.|:|
  Rat   196 RETLPAEQDLTTKNVSIGIV--GKDLEFTIYDDDDVSPFL--------DGLEERPQRK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 81/231 (35%)
proteasome_alpha_type_7 5..213 CDD:239724 75/211 (36%)
Psma1NP_058974.1 proteasome_alpha_type_1 6..216 CDD:239718 76/214 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.