DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb10

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001020808.1 Gene:Psmb10 / 291983 RGDID:1307428 Length:273 Species:Rattus norvegicus


Alignment Length:243 Identity:51/243 - (20%)
Similarity:96/243 - (39%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AVRKGSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQ 90
            |.:.|:|..|:...:.|:||.:.::. ..:..|:...||..:...:....||:.||..:....|.
  Rat    35 ARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAA 99

  Fly    91 VECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIF 155
            .:.:.|.|:......:..:||.:.|...:|     :...|.|.::||.|.:| ..|:...|.|.:
  Rat   100 SKMELHALSTGREPRVATVTRILRQTLFRY-----QGHVGASLIVGGVDLNG-PQLYSVHPHGSY 158

  Fly   156 --YEYKANATGRSAKV--VREFFEKSYREEEVANEHGAVKLAIRALLE---------------VA 201
              ..:.|..:|:.|.|  :.:.|:.:...|      .|.:|.:.|:..               |.
  Rat   159 SRLPFTALGSGQDAAVALLEDRFQPNMTLE------AAQELLVEAITAGILGDLGSGGSVDACVI 217

  Fly   202 QSGQNNLEVAIMENGKPLKML--------DTDVITDYVKIIEKEKEEE 241
            .:|...|:.|:....:|::..        .|.|.|..|:.:..|..||
  Rat   218 TAGGAKLQRALSSPIEPVQRAGQYRFAPGTTPVQTQEVRALTLELLEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 47/231 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 43/205 (21%)
Psmb10NP_001020808.1 proteasome_beta_type_7 40..226 CDD:239732 40/197 (20%)
Pr_beta_C 233..267 CDD:403609 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.