Sequence 1: | NP_525092.1 | Gene: | Prosalpha4 / 32584 | FlyBaseID: | FBgn0004066 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036101.1 | Gene: | Psmb3 / 26446 | MGIID: | 1347014 | Length: | 205 | Species: | Mus musculus |
Alignment Length: | 242 | Identity: | 44/242 - (18%) |
---|---|---|---|
Similarity: | 76/242 - (31%) | Gaps: | 89/242 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 GSTAVGVRGANCVVLGVEKKSVAQLQ-EDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQ 94
Fly 95 SHRLNVEDPVTLEYITRFIAQLKQKYTQSNGR--RPFGISCLIGGFDADGSAHLFQTEPSGIFYE 157
Fly 158 YKANATGRSAKVVREFF----------------------EKSYR------EEEVANEHGAVKLAI 194
Fly 195 RALLEVAQSGQNNLEVAIMENGKPLKMLDTDVITD---YVKIIEKEK 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha4 | NP_525092.1 | PRK03996 | 5..231 | CDD:235192 | 39/233 (17%) |
proteasome_alpha_type_7 | 5..213 | CDD:239724 | 36/212 (17%) | ||
Psmb3 | NP_036101.1 | proteasome_beta_type_3 | 6..201 | CDD:239728 | 44/242 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |