DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:224 Identity:41/224 - (18%)
Similarity:86/224 - (38%) Gaps:51/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGVRGANCVVLG---VEKKSVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSH 96
            :|::|.:.|::.   |...::.|:::|..  |:..:...:::...|...|........|...|.:
Mouse     5 IGIQGPDYVLVASDRVAASNIVQMKDDHD--KMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLY 67

  Fly    97 RL----NVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFY- 156
            ::    .:.......:..|.:|...:      .|.|:.::.|:.|:|        :.|...::| 
Mouse    68 KMRNGYELSPTAAANFTRRNLADCLR------SRTPYHVNLLLAGYD--------EHEGPALYYM 118

  Fly   157 EYKA-------NATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQSGQNNLEVAIME 214
            :|.|       .|.|..|.:.....:: |....::.|. ||:| :|..||..|            
Mouse   119 DYLAALAKAPFAAHGYGAFLTLSILDR-YYTPTISRER-AVEL-LRKCLEELQ------------ 168

  Fly   215 NGKPLKMLDTDVITDYVKIIEKEKEEELE 243
                 |....::.|..|::|:|:....||
Mouse   169 -----KRFILNLPTFSVRVIDKDGIHNLE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 36/210 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 34/192 (18%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 39/222 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.