DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psma7

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036099.1 Gene:Psma7 / 26444 MGIID:1347070 Length:248 Species:Mus musculus


Alignment Length:245 Identity:170/245 - (69%)
Similarity:204/245 - (83%) Gaps:1/245 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDN 69
            ||||:|:|||||||.|||||||||:||||||||||.:.|||||||||||:||::|.|||||.||:
Mouse     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDD 67

  Fly    70 HVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCL 134
            :|.||||||||||||:||||:||||||||.||||||:|||||:||.|||:|||||||||||||.|
Mouse    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132

  Fly   135 IGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLE 199
            |.|||.||:..|:||:|||.::.:||||.||.||.||||.||:|.::.:..:...:||.|:||||
Mouse   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLE 197

  Fly   200 VAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            |.|||..|:|:|:|...:|||:|:.:.|..||..|||||||. |||||||
Mouse   198 VVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEEN-EKKKQKK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 154/225 (68%)
proteasome_alpha_type_7 5..213 CDD:239724 148/207 (71%)
Psma7NP_036099.1 proteasome_alpha_type_7 3..211 CDD:239724 148/207 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 272 1.000 Domainoid score I1792
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 343 1.000 Inparanoid score I2316
Isobase 1 0.950 - 0 Normalized mean entropy S208
OMA 1 1.010 - - QHG62217
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm8808
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2243
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.