DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psma1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:253 Identity:85/253 - (33%)
Similarity:140/253 - (55%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            ::||..||::||.|.:.|:|||.|||::||..||::.....||...|::.::|...:|  ||..:
Mouse     4 NQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK--KILHV 66

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS 132
            |||:.::.||||||||::.|..:.||...|...:.|:.:..:...|....|..||..||||:|:.
Mouse    67 DNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVG 131

  Fly   133 CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRAL 197
            .||.|:| |...|:|||.||..:::.:|.:.|..::..|.:.|:...|....|....||..:|||
Mouse   132 LLIAGYD-DMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRAL 195

  Fly   198 LEVAQSGQN----NLEVAIMENGKPLK--MLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            .|...:.|:    |:.:.|:  ||.|:  :.|.|.::.::        :.||::.|:|
Mouse   196 RETLPAEQDLTTKNVSIGIV--GKDLEFTIYDDDDVSPFL--------DGLEERPQRK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 81/231 (35%)
proteasome_alpha_type_7 5..213 CDD:239724 75/211 (36%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 76/214 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.