DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pts1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_593825.1 Gene:pts1 / 2543623 PomBaseID:SPAC4A8.13c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:46/224 - (20%)
Similarity:102/224 - (45%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGH-LLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKK-SVAQLQEDRKVRKI 64
            ||.|.|.:|..:.:.| |:::.:       |:|.:..|..:.:|:.|:.: |...|...:.|:|:
pombe    38 SSLYLRNLTDETKNKHCLIKMNH-------GTTTLAFRYQHGIVVCVDSRASAGPLIASQTVKKV 95

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129
            ..::.:::...||..||.:.......:||:.|:|..::.:::...::.::.:...|      :.:
pombe    96 IEINPYLLGTLAGGAADCQFWETVLGMECRLHQLRNKELISVSAASKILSNITYSY------KGY 154

  Fly   130 GIS--CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKL 192
            |:|  .::.|....|:| |:..:..|...:....:.|..:.......:..||.:  .::..|:.|
pombe   155 GLSMGTMLAGTGKGGTA-LYYIDSDGTRLKGDLFSVGSGSTFAYGVLDSGYRWD--LSKQEALYL 216

  Fly   193 AIRALL-----EVAQSGQNNLEVAIMENG 216
            |.|:::     :....|..|| ..|.|||
pombe   217 AQRSIVAATHRDAYSGGSVNL-YHIDENG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 44/221 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 40/216 (19%)
pts1NP_593825.1 PRE1 39..262 CDD:223711 45/223 (20%)
proteasome_beta_type_5 62..249 CDD:239730 38/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.