DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pup2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_594372.1 Gene:pup2 / 2543205 PomBaseID:SPAC323.02c Length:247 Species:Schizosaccharomyces pombe


Alignment Length:217 Identity:81/217 - (37%)
Similarity:125/217 - (57%) Gaps:11/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            |.|||.|..|||:|.|.|||||.||::.||||:||:..:.|||||||:..:.|.|...|.|:..:
pombe     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKDAVVLGVEKRLTSPLMESHSVEKLFEI 70

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNG------R 126
            |:|:..|.:|||||||.:|..|:|:.|:||...::|..:|..|:.|..|..::.:...      .
pombe    71 DSHIGCAISGLTADARTIIEHARVQTQNHRFTYDEPQGIESTTQSICDLALRFGEGEDGEERIMS 135

  Fly   127 RPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVK 191
            ||||::.||.|.|..| ..|:.:||||.::.|:|.|.|..::..:....|.:.::....|  |..
pombe   136 RPFGVALLIAGIDEHG-PQLYHSEPSGTYFRYEAKAIGSGSEPAKSELVKEFHKDMTLEE--AEV 197

  Fly   192 LAIRALLEVAQS--GQNNLEVA 211
            |.::.|.:|.:.  ...|:::|
pombe   198 LILKVLRQVMEEKLDSKNVQLA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 80/215 (37%)
proteasome_alpha_type_7 5..213 CDD:239724 80/215 (37%)
pup2NP_594372.1 PRK03996 8..241 CDD:235192 80/215 (37%)
proteasome_alpha_type_5 8..221 CDD:239722 80/215 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.