DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and SPAC31A2.04c

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_592916.1 Gene:SPAC31A2.04c / 2543122 PomBaseID:SPAC31A2.04c Length:194 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:50/224 - (22%)
Similarity:90/224 - (40%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDNHVVMAFAGLTAD- 81
            ||.|: .|:.|...|::..|||.          :|.:..:|    |..:|::|.:|.:.|...| 
pombe     4 LLAVQ-GQDFVLTASSSSAVRGI----------TVLKPDDD----KSQILNSHNLMLYCGEAGDT 53

  Fly    82 ---ARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDAD-G 142
               |..:.....:....|.||:....|..: ||     ||..|....|:|:.::.|:.|::.: |
pombe    54 TNFAEYIAANISLYTLRHNLNLSPEATASF-TR-----KQLATSLRSRKPYQVNILLAGYETNLG 112

  Fly   143 SAHLFQTEPSGIFYEYKANAT-------GRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEV 200
            ...||       :.:|.|...       |.|:......|::.|:.:...:|  ||::......|:
pombe   113 KPELF-------WLDYLATCVRVPYACQGYSSFYCLSIFDRYYKPDLTIDE--AVRIMKLCFDEL 168

  Fly   201 AQSGQNNLEVAIMENGKPLKMLDTDVITD 229
            .:      .:.|...|...|::|.|.|.:
pombe   169 KK------RMPIDFKGFICKVVDKDGIRE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 50/224 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 44/206 (21%)
SPAC31A2.04cNP_592916.1 proteasome_beta_type_2 1..194 CDD:239727 50/224 (22%)
PRE1 1..189 CDD:223711 49/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.