DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and SPAC6G10.04c

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_594101.1 Gene:SPAC6G10.04c / 2542559 PomBaseID:SPAC6G10.04c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:80/255 - (31%)
Similarity:126/255 - (49%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            ::||...|.:||.|.|.|||||.||:::||..||:......||...|::..:|...:|  |:..:
pombe     4 NQYDGDATTWSPQGRLHQVEYALEAIKQGSATVGLVSKTHAVLVALKRNAEELSSYQK--KLIRI 66

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS 132
            |:|:.:|.|||..|||::.|..:.|..|.:.....|:.:..:...:|:..|..||..||||:|:.
pombe    67 DDHIGIAIAGLAPDARVLSNYMKQEALSSKTLFTRPIPVRRLMSKVAEKAQINTQEYGRRPYGVG 131

  Fly   133 CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEK-------SYREEEVANEHGAV 190
            .|:.|:|..| .||.:.:|||:..||...:.|..::..|.:.|:       |.|||.:.:     
pombe   132 FLVIGYDESG-PHLLEFQPSGLVLEYLGTSMGSRSQSARTYIERNLDTFPDSSREELILS----- 190

  Fly   191 KLAIRALLEVAQSGQNNLE--VAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQK 248
              |:|||.:.....|...|  |:|...||..|         |....:.:.:|.|:|...|
pombe   191 --ALRALRDTLSKDQELTEENVSISVIGKDEK---------YTLYDQNDTKEWLDKLGDK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 75/234 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 71/216 (33%)
SPAC6G10.04cNP_594101.1 PRE1 4..239 CDD:223711 79/253 (31%)
proteasome_alpha_type_1 6..216 CDD:239718 72/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.