DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb8

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:234 Identity:47/234 - (20%)
Similarity:102/234 - (43%) Gaps:32/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKS-----VAQLQEDRKVRKICMLDNHVVMAFAGL 78
            :|:|.|.     |:|.:..:..:.|::.|:.::     :|.:    :|.|:..::.:::...:|.
  Rat    65 VQIEMAH-----GTTTLAFKFQHGVIVAVDSRASAGSYIATI----RVNKVIEINPYLLGTMSGC 120

  Fly    79 TADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS--CLIGGFDAD 141
            .||.:........||:.:.|...:.:::...::.::.:..:|      |..|:|  .:|.|:|..
  Rat   121 AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQY------RGMGLSMGSMICGWDKK 179

  Fly   142 GSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQSGQN 206
            |.. |:..:.:|.....:..:||..........:..||::....|  |..||.||::........
  Rat   180 GPG-LYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEE--AYDLARRAIVYATHRDSY 241

  Fly   207 NLEVAIMENGKP---LKMLDTDVITDYVKIIEKEKEEEL 242
            :..|..|.:.|.   :|:..||| :|   ::.|.:|..|
  Rat   242 SGGVVNMYHMKKDGWVKVESTDV-SD---LLHKYREATL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 44/221 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 37/200 (19%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 44/227 (19%)
proteasome_beta_type_5 73..260 CDD:239730 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.