DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and CG30382

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:124/251 - (49%) Gaps:17/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAV-RKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKIC 65
            |:.:||.:|||||:|.|.|||||.:|: ::..|.|.::..:|.|:..:||...:......|..:.
  Fly     6 SAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLF 70

  Fly    66 MLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFG 130
            .:...:..|..|..||:|..:.:|:.|..:.|......:.::.:.|.||.:.|.|||:...||.|
  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135

  Fly   131 ISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIR 195
            .|.::..:|.:....:::|:|:|.|..:||.:.|........:.||.|:..  .:|..|::|||.
  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPN--LSEEKAIQLAIS 198

  Fly   196 ALLEV--AQSGQNNLEVAIMENGKP-LKMLDTDVITDYVKIIEKEKEEELEKKKQK 248
            .|..|  .....|.:|:.::....| .::||           |:|.||.|.|..:|
  Fly   199 CLSSVLAIDFKPNGIEIGVVSKSDPTFRILD-----------EREIEEHLTKIAEK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 64/229 (28%)
proteasome_alpha_type_7 5..213 CDD:239724 61/210 (29%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 70/248 (28%)
proteasome_alpha_type_6 8..218 CDD:239723 61/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.