DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb7

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:275 Identity:58/275 - (21%)
Similarity:105/275 - (38%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVTIFSPD-----------GHLLQVEYAQ------EAVRKGSTAVGVRGANCVVLGVEKKSV-AQ 54
            ||::|.|.           ..:|:.::|:      :|.:.|:|..||...:.:|||.:.::. ..
Mouse     3 AVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGM 67

  Fly    55 LQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQK 119
            :..|:...||..:..::....||..||..:.........:.|.|.......:....|.:.|:..:
Mouse    68 VVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFR 132

  Fly   120 YTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYR---EE 181
            |     :...|.:.::||.|..| .||:...|.|...:......|..:......||..:|   ||
Mouse   133 Y-----QGYIGAALVLGGVDVTG-PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEE 191

  Fly   182 EVANEHGAVKLAIRALLEVAQSGQNNLEVAIMENGK-----PLKMLD---------------TDV 226
            |.|.:  .|..||.|.:.......:|:::.::...|     |..:.:               |.|
Mouse   192 EEAKK--LVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAV 254

  Fly   227 ITDYVKIIEKEKEEE 241
            :|:.|..:|.|..||
Mouse   255 LTEKVTPLEIEVLEE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 53/263 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 48/225 (21%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 41/191 (21%)
proteasome_beta_type_7 44..232 CDD:239732 41/195 (21%)
Pr_beta_C 236..271 CDD:289249 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.