DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb5

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035316.1 Gene:Psmb5 / 19173 MGIID:1194513 Length:264 Species:Mus musculus


Alignment Length:186 Identity:33/186 - (17%)
Similarity:73/186 - (39%) Gaps:33/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKKSVAQLQ-EDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQ 94
            |:|.:..:..:.|::..:.::.|... ..:.|:|:..::.:::...||..||..........:|:
Mouse    59 GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCR 123

  Fly    95 SHRLNVEDPVTLEYITRFIAQLKQK-----------------------YTQSNGRRPFGISCLIG 136
            .:.|..::.:::...::.:|.:..:                       |..|.|.|..|.:..:|
Mouse   124 IYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVG 188

  Fly   137 GFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKL 192
                .||.:.:.....|..|:.|.......|:  |..::.:||:   |...|||.|
Mouse   189 ----SGSVYAYGVMDRGYSYDLKVEEAYDLAR--RAIYQATYRD---AYSGGAVNL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 33/186 (18%)
proteasome_alpha_type_7 5..213 CDD:239724 33/186 (18%)
Psmb5NP_035316.1 proteasome_beta_type_5 60..247 CDD:239730 32/185 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.