DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb10

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:253 Identity:53/253 - (20%)
Similarity:101/253 - (39%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTA 80
            |:|.......|.:.|:|..|:...:.|:||.:.::. ..:..|:...||..:...:....||:.|
Mouse    25 HVLPGLRVPHARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAA 89

  Fly    81 DARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAH 145
            |..:....|..:.:.|.|:......:..:||.:.|...:|     :...|.|.::||.|.:| ..
Mouse    90 DTEMTTRMAASKMELHALSTGREPRVATVTRILRQTLFRY-----QGHVGASLVVGGVDLNG-PQ 148

  Fly   146 LFQTEPSGIF--YEYKANATGRSAKV--VREFFEKSYREEEVANEHGAVKLAIRALLE------- 199
            |::..|.|.:  ..:.|..:|:.|.|  :.:.|:.:...|      .|.:|.:.|:..       
Mouse   149 LYEVHPHGSYSRLPFTALGSGQGAAVALLEDRFQPNMTLE------AAQELLVEAITAGILSDLG 207

  Fly   200 --------VAQSGQNNLEVAIMENGKPLKML--------DTDVITDYVKIIEKEKEEE 241
                    |..:|...|:.|:....:|::..        .|.|:|..|:.:..|..||
Mouse   208 SGGNVDACVITAGGAKLQRALSTPTEPVQRAGRYRFAPGTTPVLTREVRPLTLELLEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 49/241 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 45/215 (21%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 43/210 (20%)
proteasome_beta_type_7 40..226 CDD:239732 40/197 (20%)
Pr_beta_C 232..267 CDD:289249 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.