DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psma2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_032970.2 Gene:Psma2 / 19166 MGIID:104885 Length:234 Species:Mus musculus


Alignment Length:237 Identity:85/237 - (35%)
Similarity:141/237 - (59%) Gaps:7/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSR-YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKI 64
            |:.| |..::|.|||.|.|:|:|||..||..|:.:||::.||.|||..|||..:.|.::|.|.|:
Mouse     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKV 65

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129
            ..:..|:.:.::|:..|.|::::||:...|.:.|..::|:....:.:.:|.:.|:||||.|.|||
Mouse    66 EPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPF 130

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194
            |:|.||.|:: :|..:|||::|||.::.:||.|.|::....:.|.||.|.|:....:  |:..||
Mouse   131 GVSLLICGWN-EGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELED--AIHTAI 192

  Fly   195 RALLE--VAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKII 234
            ..|.|  ..|..::|:||.|.......::..|:| .||:..|
Mouse   193 LTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEV-RDYLAAI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 81/227 (36%)
proteasome_alpha_type_7 5..213 CDD:239724 77/209 (37%)
Psma2NP_032970.2 proteasome_alpha_type_2 6..231 CDD:239719 82/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.