DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pbs-6

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:251 Identity:45/251 - (17%)
Similarity:88/251 - (35%) Gaps:68/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVE------YAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQED- 58
            ||||               |:|      |:.|    |.:...:.|.|..::..:.:   ..|.| 
 Worm    34 MSSR---------------QIERQRWNPYSME----GGSTCAISGENFAIVASDTR---MTQNDI 76

  Fly    59 ----RKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLE----------YI 109
                |...||.:|::::::..:|...|...:....|.....:|.:....::::          |.
 Worm    77 NILTRDAEKIQILNDNIILTTSGFYGDVLQLKKVLQSRLHKYRFDYRSDMSVDLCAELLSRNLYY 141

  Fly   110 TRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFF 174
            .||.              |:....::.|.|..|...:|..:|.|.......:|:|.:..::..|.
 Worm   142 RRFF--------------PYYTGAILAGIDEHGKGAVFSYDPIGCIERLGYSASGAAEPMIIPFL 192

  Fly   175 E---------KSYREEEVANEH--GAVKLAIRALLEVAQSGQNNLEVAIMENGKPL 219
            :         :.|...|:..:.  ..:|.:.|...|...|..:.:.:.|.|.|||:
 Worm   193 DCQIGHVTLSEGYERPELTLDRAISLMKDSFRGAAEREISTGDKIHLVIAEAGKPV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 41/247 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 36/239 (15%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 38/228 (17%)
Ntn_hydrolase 44..258 CDD:294319 39/226 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.