DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pas-7

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_496177.2 Gene:pas-7 / 174571 WormBaseID:WBGene00003928 Length:250 Species:Caenorhabditis elegans


Alignment Length:246 Identity:73/246 - (29%)
Similarity:123/246 - (50%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDN 69
            ||.|.:.|||||.:.||||||:||....|.:.:||.|.||:..:|...::|..|....::..:::
 Worm     8 YDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYTDNANPRMFNVND 72

  Fly    70 HVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCL 134
            :|.:|.||...|...:.|.|..|......:..:|:.::.|...:|:....:|.... ||||....
 Worm    73 NVGVAVAGNYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYIHIHTLGIS-RPFGAGAF 136

  Fly   135 IGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLE 199
            ...::......||..||||:.|||||.|.|:..:..:...||...||...|:  .||.|.|.::.
 Worm   137 FMSWNKQTGGRLFLVEPSGLNYEYKAWAVGKHRQAAKAEIEKLKIEELDVNQ--LVKEAARIIMV 199

  Fly   200 VAQSGQN-NLEVAI-----MENGKPLKMLDTDVITDYVK-IIEKEKEEELE 243
            |....:: |:::.:     ..||| .:.:.::|:|...: .|.|..|::::
 Worm   200 VRDENKDKNVQIEMGWVGEQTNGK-YEEVPSEVVTAAEEWAIAKLDEDDMD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 70/231 (30%)
proteasome_alpha_type_7 5..213 CDD:239724 65/213 (31%)
pas-7NP_496177.2 proteasome_alpha_type_3 5..216 CDD:239720 65/210 (31%)
PRE1 6..231 CDD:223711 68/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.