Sequence 1: | NP_525092.1 | Gene: | Prosalpha4 / 32584 | FlyBaseID: | FBgn0004066 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493558.1 | Gene: | pbs-5 / 173334 | WormBaseID: | WBGene00003951 | Length: | 284 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 39/207 - (18%) |
---|---|---|---|
Similarity: | 83/207 - (40%) | Gaps: | 26/207 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LQVEYAQEA-----VRKGSTAVGV---------RGANCVVLGVEKK-SVAQLQEDRKVRKICMLD 68
Fly 69 NHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISC 133
Fly 134 LIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALL 198
Fly 199 EVA--QSGQNNL 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha4 | NP_525092.1 | PRK03996 | 5..231 | CDD:235192 | 39/207 (19%) |
proteasome_alpha_type_7 | 5..213 | CDD:239724 | 39/207 (19%) | ||
pbs-5 | NP_493558.1 | Ntn_hydrolase | 65..252 | CDD:320988 | 34/189 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |