DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pbs-5

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:207 Identity:39/207 - (18%)
Similarity:83/207 - (40%) Gaps:26/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEA-----VRKGSTAVGV---------RGANCVVLGVEKK-SVAQLQEDRKVRKICMLD 68
            ::..:|:.|     .|||:|.:..         :|.  :::.|:.: |..:....:.|.||..:.
 Worm    47 MKTHFAETAGKSMQFRKGTTTLAFVYEPATPADKGG--IIVAVDSRASSGEYISSKSVMKILDIG 109

  Fly    69 NHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISC 133
            :.:|...||..||.:.........|..:.|..:..:|:...:::.|.....| :..|   ..:..
 Worm   110 DRMVATMAGGAADCQFWTRIVAKYCTLYELREKTSITVSAASKYFANTLYGY-RGQG---LSVGS 170

  Fly   134 LIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALL 198
            ::.|:|..| ..:|:.:..|...:.|..:.|..:.......:..|:.:...:|  |.||.:||::
 Worm   171 MVAGYDKKG-PQIFKVDSEGDRCQLKVCSVGSGSLNAYGILDNHYKPKMTDDE--ARKLGLRAIM 232

  Fly   199 EVA--QSGQNNL 208
            ...  .||...:
 Worm   233 HATYRDSGSGGV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 39/207 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 39/207 (19%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 34/189 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.