DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pbs-2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:210 Identity:53/210 - (25%)
Similarity:78/210 - (37%) Gaps:42/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQEAVRKGSTAVGVRGANCVVLGVEKKSVA-QLQEDRKVRKICMLDNHVVMAFAGLTADARIMIN 87
            |.:....|:|.|.|.....:|:|.:.::.| .:..|:...|:..|...:....||..||.     
 Worm    39 APKLTSTGTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAADL----- 98

  Fly    88 RAQVECQSHRLNVEDPVT---------LEYIT----RFIAQLKQ-KYTQSNGRRPFGISCLIGGF 138
                          |.||         ||..|    |.|..|:| |....|.:...|...||||.
 Worm    99 --------------DQVTKMLSGNLRLLELNTGRKARVITALRQAKQHLFNYQGYIGAYLLIGGV 149

  Fly   139 DADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQS 203
            |..| .||:....:|....:...|.|..:.......|:.::.:...:|  |.||..|| ||....
 Worm   150 DPTG-PHLYMCSANGTTMAFPFTAQGSGSYAAITILERDFKVDMTKDE--AEKLVQRA-LEAGMH 210

  Fly   204 GQ----NNLEVAIME 214
            |.    |:|.:.|:|
 Worm   211 GDNASGNSLNLVIIE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 53/210 (25%)
proteasome_alpha_type_7 5..213 CDD:239724 51/207 (25%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 52/206 (25%)
proteasome_beta_type_7 47..235 CDD:239732 51/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.