Sequence 1: | NP_525092.1 | Gene: | Prosalpha4 / 32584 | FlyBaseID: | FBgn0004066 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493271.1 | Gene: | pbs-2 / 173168 | WormBaseID: | WBGene00003948 | Length: | 277 | Species: | Caenorhabditis elegans |
Alignment Length: | 210 | Identity: | 53/210 - (25%) |
---|---|---|---|
Similarity: | 78/210 - (37%) | Gaps: | 42/210 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 AQEAVRKGSTAVGVRGANCVVLGVEKKSVA-QLQEDRKVRKICMLDNHVVMAFAGLTADARIMIN 87
Fly 88 RAQVECQSHRLNVEDPVT---------LEYIT----RFIAQLKQ-KYTQSNGRRPFGISCLIGGF 138
Fly 139 DADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQS 203
Fly 204 GQ----NNLEVAIME 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha4 | NP_525092.1 | PRK03996 | 5..231 | CDD:235192 | 53/210 (25%) |
proteasome_alpha_type_7 | 5..213 | CDD:239724 | 51/207 (25%) | ||
pbs-2 | NP_493271.1 | PRE1 | 43..228 | CDD:223711 | 52/206 (25%) |
proteasome_beta_type_7 | 47..235 | CDD:239732 | 51/202 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |