DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and pas-3

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001379751.1 Gene:pas-3 / 172139 WormBaseID:WBGene00003924 Length:250 Species:Caenorhabditis elegans


Alignment Length:258 Identity:86/258 - (33%)
Similarity:143/258 - (55%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDR-KVRKI 64
            |:.|||...|||||:|.|.|||||.||:....|.:|:..:..:|:..|:|:|.:|.:|. ...|:
 Worm     1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILSSEGIVVAAERKNVHKLLDDSVMTEKV 65

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129
            ..|.:::....||:||||.|:||..:....|:|.:..:.:.:|.:.:.:...||:|||..|:|||
 Worm    66 YRLSDNISCTVAGITADANILINHLRWWAASYRNSYGEEMPVEQLVQNLCNEKQRYTQIGGKRPF 130

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194
            |:|.|..|:|......|:|::|||.:..:||...|.:.:......::.|:.   .|...|.:|||
 Worm   131 GVSLLYIGWDKHYGYQLYQSDPSGNYTGWKATCIGSNHQAAVTLLKQEYKS---PNLEEAKQLAI 192

  Fly   195 RAL---LEVAQSGQNNLEVAIM--ENGKPL------KMLDTDVITDYVKIIEKEKEEELEKKK 246
            :.|   |:|..:.: .:|:|::  .:||.:      |.:|. :|.::.|   ||||.|..:||
 Worm   193 KVLWKTLDVKLASE-KVEMAVLTRRDGKTVLEELTTKEVDA-LIAEHEK---KEKEAETAEKK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 76/237 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 71/211 (34%)
pas-3NP_001379751.1 proteasome_alpha_type_4 3..213 CDD:239721 72/213 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.