DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psma6a

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:241 Identity:66/241 - (27%)
Similarity:127/241 - (52%) Gaps:5/241 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAVRKGS-TAVGVRGANCVVLGVEKKSVAQLQEDRKVRKIC 65
            |:.:||.:|||||:|.|.|||||.:|:.:|. |:|.|||.:|.|:..::|...:|.:...|..:.
Zfish     6 SAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKLLDSSTVTHLF 70

  Fly    66 MLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFG 130
            .:..::....:|:|||:|..:.||:.|..:.:......:.::.:.:.||.:.|.|||:...||.|
Zfish    71 RITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLG 135

  Fly   131 ISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIR 195
            ...::.|.|.:....:::.:|:|.:..:||.|.|........|.||..:::........|:.||.
Zfish   136 CCMIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKIKKKLDWTFDQTVETAIS 200

  Fly   196 ALLEV--AQSGQNNLEVAIMENGKP-LKML-DTDVITDYVKIIEKE 237
            .|..|  .....:.||:.::...:| .::| ::::.|..:.:.|::
Zfish   201 CLSTVLAIDFKPSELEIGVVTTEEPKFRILSESEIDTHLMALTERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 64/230 (28%)
proteasome_alpha_type_7 5..213 CDD:239724 61/210 (29%)
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 65/232 (28%)
proteasome_alpha_type_6 8..220 CDD:239723 61/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.