DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb8

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:182 Identity:34/182 - (18%)
Similarity:79/182 - (43%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVA-QLQEDRKVRKICMLDNHVVMAFAGLTADA 82
            :|:|.|.     |:|.:..:..:.|::.|:.::.| ......::.|:..::.:::...:|..||.
Mouse    65 VQIEMAH-----GTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAADC 124

  Fly    83 RIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS--CLIGGFDADGSAH 145
            :........||:.:.|...:.:::...::.::.:..:|      |..|:|  .:|.|:|..|.. 
Mouse   125 QYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQY------RGMGLSMGSMICGWDKKGPG- 182

  Fly   146 LFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRAL 197
            |:..:.:|.....:..:||..........:..||::....|  |..|..||:
Mouse   183 LYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEE--AYDLGRRAI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 34/182 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 34/182 (19%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 34/182 (19%)
proteasome_beta_type_5 73..260 CDD:239730 30/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.