DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PSMA8

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_653263.2 Gene:PSMA8 / 143471 HGNCID:22985 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:177/255 - (69%)
Similarity:209/255 - (81%) Gaps:7/255 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKIC 65
            |:||||||:|:|||||||.|||||||||:|||||||:||.|.|||||||||||:||::|.|||||
Human     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKIC 65

  Fly    66 MLDNHVVMAFA------GLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSN 124
            .||:||.||||      |||||||::||||:||||||:|.||||||:||||||||.|||||||||
Human    66 ALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSN 130

  Fly   125 GRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGA 189
            ||||||||.||.|||.||.:.|:||:|||.::.:||||.|||||.||||.||:|.|:.:|::..|
Human   131 GRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEA 195

  Fly   190 VKLAIRALLEVAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            :||||:|||||.|||..|:|:||:...:||||.....:..||..||||| ||.||||.||
Human   196 IKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEIEKEK-EEAEKKKSKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 159/231 (69%)
proteasome_alpha_type_7 5..213 CDD:239724 154/213 (72%)
PSMA8NP_653263.2 PRK03996 5..237 CDD:235192 159/231 (69%)
proteasome_alpha_type_7 5..219 CDD:239724 154/213 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 267 1.000 Domainoid score I1879
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2086
Inparanoid 1 1.050 346 1.000 Inparanoid score I2313
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm8580
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2243
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.