DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and AgaP_AGAP001995

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_550819.1 Gene:AgaP_AGAP001995 / 1281126 VectorBaseID:AGAP001995 Length:234 Species:Anopheles gambiae


Alignment Length:233 Identity:88/233 - (37%)
Similarity:139/233 - (59%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICM 66
            |.||..::|.|||.|.|:|:|||..||..|:.:||::..|.||:..|.|..:.|.::..|.|:.|
Mosquito     3 SERYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKAVNGVVIATENKQKSILYDEHSVHKVEM 67

  Fly    67 LDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGI 131
            :.||:.|.::|:..|.|:::.:|:...|::.|...:|:....:.:.:|.:.|:||||.|.||||:
Mosquito    68 VTNHIGMIYSGMGPDYRLLVKQARKLAQNYYLTYREPIPTSQLVQKVATVMQEYTQSGGVRPFGV 132

  Fly   132 SCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRA 196
            |.||.|:| ||..:|||.:|||.::.:||.|.|::|...:.|.||.|.|:...::  ||..||..
Mosquito   133 SLLICGWD-DGRPYLFQCDPSGAYFAWKATAMGKNANNGKTFLEKRYSEDLELDD--AVHTAILT 194

  Fly   197 LLE--VAQSGQNNLEVAIME-NGKPLKMLDTDVITDYV 231
            |.|  ..|...:|:||.|.: ||  .:.||...:.||:
Mosquito   195 LKEGFEGQMNADNIEVGICDANG--FRRLDPSDVQDYL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 85/228 (37%)
proteasome_alpha_type_7 5..213 CDD:239724 79/209 (38%)
AgaP_AGAP001995XP_550819.1 proteasome_alpha_type_2 6..231 CDD:239719 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.