DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and AgaP_AGAP003935

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_318387.2 Gene:AgaP_AGAP003935 / 1278761 VectorBaseID:AGAP003935 Length:246 Species:Anopheles gambiae


Alignment Length:241 Identity:70/241 - (29%)
Similarity:124/241 - (51%) Gaps:5/241 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAV-RKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKIC 65
            |:.:||.:|||||:|.|.|||||.:|: ::|.|::.::|.:|.|:..:||...:|.:...|..:.
Mosquito     6 SAGFDRHITIFSPEGRLYQVEYAFKAINQEGLTSIALKGKDCAVVATQKKIPDKLIDPATVTHLY 70

  Fly    66 MLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFG 130
            .:...:.....|..||:|..:.||:.|..:.|......:.::.:.|.:|.:.|.|||:...||.|
Mosquito    71 RITREIGCVMTGRIADSRSQVQRARYEAANWRYKYGYEIPVDVLCRRMADISQVYTQNAEMRPLG 135

  Fly   131 ISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIR 195
            .|.::..|||:....:::|:|:|.:..|.|.:.|........:.||..:.:...:|...::|||.
Mosquito   136 CSIVMIAFDAENGPAVYKTDPAGYYCGYHAISVGVKQTEANSYLEKKLKRKAELSEEETIQLAIT 200

  Fly   196 ALLEV--AQSGQNNLEVAIMENGKP-LKMLDTDVITDYV-KIIEKE 237
            .|..|  .......:|:.|:...|| .:.|..|.|..:: .|.||:
Mosquito   201 CLSTVLAVDFKPTEIEIGIVSKEKPEFRTLTEDEIEVHLTAIAEKD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 66/229 (29%)
proteasome_alpha_type_7 5..213 CDD:239724 60/210 (29%)
AgaP_AGAP003935XP_318387.2 PRE1 7..245 CDD:223711 67/237 (28%)
proteasome_alpha_type_6 8..220 CDD:239723 60/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.