DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and AgaP_AGAP008816

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_314945.1 Gene:AgaP_AGAP008816 / 1275676 VectorBaseID:AGAP008816 Length:242 Species:Anopheles gambiae


Alignment Length:236 Identity:77/236 - (32%)
Similarity:132/236 - (55%) Gaps:10/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            |.|||.|..|||:|.|.|||||.||::.||||:|:...:.||:.|||:..:.|.|..|:.||..:
Mosquito     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKFGSTAIGISTPDGVVMAVEKRITSSLIEPSKMEKIVEV 70

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKY-----TQSNGRR 127
            |.|:..|.:||.||:|.:::||::|||:|.....:.:::|...:.::.:..::     |.|...|
Mosquito    71 DRHIGCATSGLMADSRTLLDRARIECQNHWFVYNERMSVESCAQAVSNVAIQFGDGDDTDSAMSR 135

  Fly   128 PFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKL 192
            |||::.|..|.: :|...|:..:|||.:..:.|.|.|..::..::..::.|.......|  |:.|
Mosquito   136 PFGVAILFAGIE-NGEPQLWHMDPSGTYIRFDAKAIGSGSEGAQQNLQEYYLPTMTIKE--AINL 197

  Fly   193 AIRALLEVAQSGQN--NLEVAIMENGKPLKMLDTDVITDYV 231
            |:..|.:|.:...|  |:||..|...:..:|...:.:.:|:
Mosquito   198 ALSTLKQVMEEKLNSTNVEVMTMTPKELFRMFSKEEVEEYI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 75/232 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 73/214 (34%)
AgaP_AGAP008816XP_314945.1 PRK03996 8..240 CDD:235192 76/234 (32%)
proteasome_alpha_type_5 8..220 CDD:239722 73/214 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.