DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and AT4G15165

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana


Alignment Length:215 Identity:63/215 - (29%)
Similarity:100/215 - (46%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQ-LQEDRKVRKI 64
            ||.|||...|||||:|.|.|||||.||:....:|:|:...:.|||..|||..:: ||....:.|:
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKM 65

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129
            ..:|:||..|.||:.:||.|:||.|:|:.|.                                  
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQR---------------------------------- 96

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194
                    :|.:....|:.::|||.:..::|.|.|.:.:..:...::.|:::....|  .|:|||
plant    97 --------WDRNHGFQLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDDATREE--VVQLAI 151

  Fly   195 RALLEVAQSGQ---NNLEVA 211
            :.|.:...|..   ..||:|
plant   152 KVLSKTMDSTSLTAEKLELA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 60/211 (28%)
proteasome_alpha_type_7 5..213 CDD:239724 60/211 (28%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:382028 61/213 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.