DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and panx2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_012815672.1 Gene:panx2 / 100486454 XenbaseID:XB-GENE-981288 Length:675 Species:Xenopus tropicalis


Alignment Length:243 Identity:47/243 - (19%)
Similarity:74/243 - (30%) Gaps:102/243 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MLDNHVVMAFAGLTAD------------------ARIMINRAQVECQSHRLNVEDP--------- 103
            ::|||..||.|.|..:                  |.:|:          :|.:|.|         
 Frog     4 IIDNHPDMATALLAGEKLKELILPGQQDDRAGSLAALMV----------QLKLELPFDRVVTIGT 58

  Fly   104 -------VTLEYITRFIAQLKQKYTQSNGRRPFGISC----------LIGGFDADGSAHLFQTE- 150
                   |||.:...|..:....||..|..|...:..          .:.|.|......||:.: 
 Frog    59 VLIPILLVTLVFTKNFAEEPIYCYTPQNFTRDQALYARGYCWTELKDALPGVDISQWPSLFEHKF 123

  Fly   151 -P------SGIFY------EYKANATGRSAKVVREFFEKSYREEEVAN-EHGAVKLAIRALLEVA 201
             |      :||.|      |:.|:        .|...|.::..:|:.| .|.|           |
 Frog   124 LPYALLAFAGIMYIPALGWEFLAS--------TRLTSELNFLLQEIDNCYHRA-----------A 169

  Fly   202 QSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            :.....:|..|...|.              .|.|:||.|.:|..:::|
 Frog   170 EGRAPKIEKQIQSKGP--------------SITEREKREIIENAEKEK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 40/223 (18%)
proteasome_alpha_type_7 5..213 CDD:239724 38/205 (19%)
panx2XP_012815672.1 Innexin 58..>160 CDD:383201 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.