DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psmb11b

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:276 Identity:50/276 - (18%)
Similarity:81/276 - (29%) Gaps:99/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKKSVAQLQEDRKVR-----KICMLDNHVVMAFAGLTADA----RIMI 86
            |:|.:|......|:...:.:|...    .||.     |:..:.:|:|...:|.:||.    ||:.
Zfish   109 GTTTLGFAFQGGVIAAADTRSSCA----GKVACPASPKVLPIHSHLVGTTSGTSADCALWKRILA 169

  Fly    87 NRAQVECQSHRLNV--------------------------------------EDPVTLEYITRFI 113
            ...::....||..:                                      |.|:|..|....:
Zfish   170 RELRLYQLRHRRRLSTGGAAKLLSHMLHPFKGTELCVAATLCGWDGDEDQDNEQPMTERYANTTL 234

  Fly   114 AQLKQK-----------------YTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKAN 161
            ......                 |..|:|.|..|....:|    .||.:.:.....|:.:...|.
Zfish   235 TSKSSSQSAASSGLSGVRGPRVVYVCSDGLRLQGALFSVG----SGSPYAYSILDGGVRWGMSAQ 295

  Fly   162 ATGRSAKVVRE-FFEKSYREEEVANEHGAVKLAIRALLEVAQSGQNNLEVAIMENGKPLKMLDTD 225
               .:|.|.|| .:..:||:....|...        |..|...|....|   .||.|        
Zfish   296 ---EAAAVAREAVYRATYRDAYSGNNVD--------LYHVTAKGWRRRE---RENLK-------- 338

  Fly   226 VITDYVKIIEKEKEEE 241
              .:|.:  |||:.|:
Zfish   339 --EEYYR--EKERREQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 45/264 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 42/246 (17%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 40/241 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.