DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and ECH2

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_177742.2 Gene:ECH2 / 843947 AraportID:AT1G76150 Length:309 Species:Arabidopsis thaliana


Alignment Length:301 Identity:113/301 - (37%)
Similarity:166/301 - (55%) Gaps:28/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 EDAFEFNSKELITYALGIGASVKNAKD---MRFLYENDAD--FAAIPTF---FVLPGLLLQMSTD 371
            |..:.:|.:::..|||||||..::|.|   ::|:|..:..  ...:|||   |.|..|     |:
plant    20 ETRYTYNERDVAIYALGIGACGQDAVDSDELKFVYHRNGQDLIQVLPTFASLFTLGSL-----TE 79

  Fly   372 KLLSKALPNSQVDFSNILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDE-S 435
            .|   .||..:.|.|.:|||:||:||...||:..:|:....:..:.|||..|::...:.|::| |
plant    80 GL---DLPGFKYDPSLLLHGQQYIEIYRPLPSKASLINKVSLAGLQDKGKAAILELETRSYEEGS 141

  Fly   436 GRLLVRNQSTTFIVGAGKFGGKKDPIA--------GVVPLQPAPNRQPDATVQYTTSEDQAALYR 492
            |.||..|::|.|:.|||.|.....|.:        |:.  ...|.|||....:..|...||.|||
plant   142 GELLCMNRTTVFLRGAGGFSNSSQPFSYKNYPSNQGLA--VKIPQRQPLTVCEERTQPSQALLYR 204

  Fly   493 LSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQ 557
            ||||.||||.||:.|.||||..|||||||||||:::|::......:|...|.:..||...|.||:
plant   205 LSGDYNPLHSDPEFAKLAGFPRPILHGLCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVFPGE 269

  Fly   558 TLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLKSSQAKL 598
            ||..::|.:|.|:.::|.|.|..|.|::| |||::...:.|
plant   270 TLITEMWLEGLRVIYQTKVKERNKTVLAG-YVDIRGLSSSL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611
PRK07791 11..248 CDD:236099
PLN02864 315..598 CDD:178455 112/299 (37%)
hot_dog <383..442 CDD:294345 22/59 (37%)
HDE_HSD 471..592 CDD:239532 58/120 (48%)
ECH2NP_177742.2 PLN02864 1..309 CDD:178455 112/299 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2042
eggNOG 1 0.900 - - E1_COG2030
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H358
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1120431at2759
OrthoFinder 1 1.000 - - FOG0005261
OrthoInspector 1 1.000 - - oto3134
orthoMCL 1 0.900 - - OOG6_101391
Panther 1 1.100 - - LDO PTHR13078
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3784
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.