DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and CG13833

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:264 Identity:71/264 - (26%)
Similarity:118/264 - (44%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEA---- 72
            |.||||||||.||||..:|..|::|..:.|.|:..:.:.|...|      :.:|.|...:|    
  Fly    52 GEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQ------IQDIYKVRAKAYKAN 110

  Fly    73 VADYNSVID-GAKVIETAIKAFGRVDILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQA 136
            |.:|:.::: .:||:|    ..|.|.:||||||::..|::......|..|:.:|:|...|.....
  Fly   111 VTNYDDLVELNSKVVE----EMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLV 171

  Fly   137 AFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIE---GARNNVLCNVIVPT 198
            ..|.||:...|.|:..||.:|::.......||..|.|.:....|:.:|   ..:.::....::|:
  Fly   172 FLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPS 236

  Fly   199 ---AASRMTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVL 260
               ..|.:|: :...|.|.::.|......||.             ...||      ||||:..:.
  Fly   237 FLRTNSDVTQ-LTHTIGFGDVYPLFTGEEVAQ-------------RIVAG------MVRGEAEIT 281

  Fly   261 RPSL 264
            .|.:
  Fly   282 VPGM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 70/255 (27%)
PRK07791 11..248 CDD:236099 66/246 (27%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
CG13833NP_651111.1 adh_short 53..241 CDD:278532 56/197 (28%)
NADB_Rossmann 54..297 CDD:304358 70/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.