DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and naz

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:337 Identity:72/337 - (21%)
Similarity:126/337 - (37%) Gaps:105/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RVAVVTGAGAGLGREYALLFAERGAKVVV--NDLGGTHSGDGASQRAADIV------------VD 63
            ::.||||..:|:|.|.|...|.||.::::  .:|       .|.:|||.|:            :|
  Fly    50 QIVVVTGGNSGIGFEIAQALAGRGGRIILACRNL-------EAGKRAAAIIKRELGCRTPLNSLD 107

  Fly    64 E----------------------IRKAGGEAVADYNSVIDGAKVIETAIKAFGRVDILVNNAGIL 106
            |                      :....|:.:|:                 |.|:|:||||||::
  Fly   108 EDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAE-----------------FERIDVLVNNAGVV 155

  Fly   107 RDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAK 171
            ...:.:.| |..:...:.|:....|..|....|::::...|||:..|:::          :..||
  Fly   156 FANTQMPT-EDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHA----------HQGAK 209

  Fly   172 MGLIGLANT-------VAIEGARNNVLCNVIVPTAASRMTEGILPDILFNELKPKLI-------- 221
            :......|.       .|.|...::.||.::.....:|..:|  ..:..|...|.|:        
  Fly   210 IDFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKG--TSVTVNCCTPGLVRGTRHFRN 272

  Fly   222 APVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLR----PSLDDPVTIEYVKD---VWSN 279
            :|:::.||.::       :.....|....:...|....:|    |.|.: ||.||..|   ..|:
  Fly   273 SPLMSSLCVKA-------VTYPWMWLFMKNAYEGAQCAIRLATDPQLKE-VTGEYFNDCEIAASS 329

  Fly   280 VTDMSK--AKHL 289
            ||...|  ||.|
  Fly   330 VTGQDKELAKKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 57/294 (19%)
PRK07791 11..248 CDD:236099 56/285 (20%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
nazNP_001287387.1 FabG 47..318 CDD:223959 62/312 (20%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 72/337 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.