Sequence 1: | NP_001285318.1 | Gene: | Mfe2 / 32582 | FlyBaseID: | FBgn0030731 | Length: | 598 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285735.1 | Gene: | Wwox / 34090 | FlyBaseID: | FBgn0031972 | Length: | 409 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 51/207 - (24%) |
---|---|---|---|
Similarity: | 82/207 - (39%) | Gaps: | 53/207 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGE----A 72
Fly 73 VADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAA 137
Fly 138 FPYMKKQ-----NY-GRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEG----------- 185
Fly 186 -ARNNV-LCNVI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mfe2 | NP_001285318.1 | hydroxyacyl-CoA-like_DH_SDR_c-like | 8..257 | CDD:187611 | 51/207 (25%) |
PRK07791 | 11..248 | CDD:236099 | 51/207 (25%) | ||
PLN02864 | 315..598 | CDD:178455 | |||
hot_dog | <383..442 | CDD:294345 | |||
HDE_HSD | 471..592 | CDD:239532 | |||
Wwox | NP_001285735.1 | WW | 13..43 | CDD:197736 | |
WW | 54..86 | CDD:197736 | |||
PRK06196 | 104..402 | CDD:235736 | 51/207 (25%) | ||
human_WWOX_like_SDR_c-like | 121..402 | CDD:187669 | 51/207 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45447669 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |