DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and Wwox

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:82/207 - (39%) Gaps:53/207 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGE----A 72
            ||.|::|||..|:|.|.|...|..|.:::. ......|.:.|.:|.|     :.|.|...    |
  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIF-ACRNRSSAEAAIERIA-----QERPAARSRCRFA 179

  Fly    73 VADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAA 137
            ..|.:|:....:.:|...::...:|.|:.|||:.   :|..|...|       .|:.:|:.:..:
  Fly   180 ALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVF---ALPYTRTVD-------GLETTFQVSHLS 234

  Fly   138 FPYMKKQ-----NY-GRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEG----------- 185
            ..|:..|     :| .|||:.||.|..:.|....|              :|:..           
  Fly   235 HFYLTLQLETLFDYKTRIIVLSSESHRFANLPVEN--------------LAVHHLSPPPEKYWSM 285

  Fly   186 -ARNNV-LCNVI 195
             |.||. ||||:
  Fly   286 MAYNNAKLCNVL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 51/207 (25%)
PRK07791 11..248 CDD:236099 51/207 (25%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 51/207 (25%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 51/207 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.