DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and CG15629

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:241 Identity:64/241 - (26%)
Similarity:111/241 - (46%) Gaps:42/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEAVADY 76
            |:|.::||.|.|:||..||.||...|::|:.|:         :|.|....||.:.|.|.:....|
  Fly    56 GQVVLITGGGGGVGRLIALNFARLQARIVIWDI---------NQEAIKTTVDLLAKHGYDNCKGY 111

  Fly    77 -NSVIDGAKVIETA---IKAFGRVDILVNNAGI--------LRDRSLVKTSEQDWNLVNDVHLKG 129
             ..:.|..::.:.|   .:..|.||||:|||||        |.||.:..|        .::::..
  Fly   112 VVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPFWELHDRVIQNT--------YNINIIS 168

  Fly   130 SFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTV-------AIEGAR 187
            .:...:|..|:|.:.|.|.|:...|.:|:.|.:|..:|.|.|...||...::       ..:..:
  Fly   169 HYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSDYAATKYACIGFHESLLTDLKAHGYDQIQ 233

  Fly   188 NNVLCNVIVPTAASRMTEGILPDILFNELKPKLIAPVV--AYLCHE 231
            .:::|...:.|.   |..|:.|.:: ..|:|:.:|..:  |..|:|
  Fly   234 MSLICPYYINTG---MFSGVRPRMM-PMLEPQYVADRIENAVRCNE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 64/241 (27%)
PRK07791 11..248 CDD:236099 64/241 (27%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 63/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.