DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and CG31810

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:200 Identity:54/200 - (27%)
Similarity:86/200 - (43%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GRVAVVTGAGAGLGREYALLFAERGAKVVV------------NDLGGTHSGDGASQRAADIVVDE 64
            |..||||||..|:|:|||...|.:|..:|:            |::|..:     :.:...||.|.
  Fly    56 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQY-----NVKIKWIVADF 115

  Fly    65 IRKAGGEAVADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRD-RSLVKTSEQD-WNLVNDVHL 127
            .:  |.|..|.....::|.:           |.|||||.|.:.| .||.|.||.. |:|:. |::
  Fly   116 AK--GREVYAHIEKELNGIE-----------VGILVNNVGTIHDPESLDKVSEDMLWDLLT-VNV 166

  Fly   128 KGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLC 192
            ......|:...|.|..:..|.|:...|:|.:..:.....|.|.|..:......:..|.|.:|:..
  Fly   167 GSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHV 231

  Fly   193 NVIVP 197
            .:::|
  Fly   232 QLVMP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 53/199 (27%)
PRK07791 11..248 CDD:236099 53/199 (27%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 53/199 (27%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 53/199 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.