Sequence 1: | NP_001285318.1 | Gene: | Mfe2 / 32582 | FlyBaseID: | FBgn0030731 | Length: | 598 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097168.1 | Gene: | CG31809 / 318954 | FlyBaseID: | FBgn0051809 | Length: | 316 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 54/200 - (27%) |
---|---|---|---|
Similarity: | 86/200 - (43%) | Gaps: | 33/200 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 GRVAVVTGAGAGLGREYALLFAERGAKVVV------------NDLGGTHSGDGASQRAADIVVDE 64
Fly 65 IRKAGGEAVADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRD-RSLVKTSEQD-WNLVNDVHL 127
Fly 128 KGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLC 192
Fly 193 NVIVP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mfe2 | NP_001285318.1 | hydroxyacyl-CoA-like_DH_SDR_c-like | 8..257 | CDD:187611 | 53/199 (27%) |
PRK07791 | 11..248 | CDD:236099 | 53/199 (27%) | ||
PLN02864 | 315..598 | CDD:178455 | |||
hot_dog | <383..442 | CDD:294345 | |||
HDE_HSD | 471..592 | CDD:239532 | |||
CG31809 | NP_001097168.1 | 17beta-HSD1_like_SDR_c | 48..286 | CDD:187614 | 53/199 (27%) |
DltE | 50..302 | CDD:223377 | 52/197 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45447666 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |