DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and CG30495

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:332 Identity:76/332 - (22%)
Similarity:123/332 - (37%) Gaps:90/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKLRYD----GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIR 66
            ||.|..    |:||:|||...|||:|..:..|.|||.|.:    ...:.:...:...:||    :
  Fly    35 GKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYM----ACRNKEKVERARREIV----K 91

  Fly    67 KAGGEAV----ADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRDRSLVKTSEQDWNL-VNDVH 126
            :.|...|    .|.:|:....|..|...|....:.||:||||:..:...:.....:.:| ||.: 
  Fly    92 ETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHI- 155

  Fly   127 LKGSFKCTQAAFPYMKKQNYGRIIMTSS-------------NSGIYGNFGQVNYTAAKMGLI--- 175
              |.|..|......:::....|:::.:|             ||..:.:.| |.|..:|:..|   
  Fly   156 --GHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFYDEG-VAYCQSKLANILFT 217

  Fly   176 -------------------GLANTVAIEGARNNVLCNVIVPTAASRMTEGILPDILFNELK-PKL 220
                               |:|:|   |.|||.:....   ..|..:.|.||..:|:..:| || 
  Fly   218 RELAKRLEGTGVTVNALNPGIADT---EIARNMIFFQT---KFAQYVVETILRPLLWAVMKTPK- 275

  Fly   221 IAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGK---GAVLRP----SLDDPVTIEYVKDVWS 278
                           ||:.....|.....|..|.|:   ...|.|    :|||    :..:.:|:
  Fly   276 ---------------NGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDD----QMAQWLWA 321

  Fly   279 NVTDMSK 285
            .....:|
  Fly   322 QSEKWAK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 67/296 (23%)
PRK07791 11..248 CDD:236099 63/281 (22%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
CG30495NP_001260785.1 FabG 44..296 CDD:223959 65/285 (23%)
NADB_Rossmann 45..323 CDD:304358 72/315 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.