DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and dhrs-4

DIOPT Version :9

Sequence 1:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_506230.1 Gene:dhrs-4 / 179772 WormBaseID:WBGene00010063 Length:260 Species:Caenorhabditis elegans


Alignment Length:254 Identity:71/254 - (27%)
Similarity:118/254 - (46%) Gaps:37/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEAV 73
            |::|:||:||.|..|:|...|....:.||.||:.         ..:|:..|..::.::..|...|
 Worm     7 RFEGKVAIVTAATKGIGLAIAERLLDEGASVVIG---------SRNQKNVDEAIEYLKNKGLTKV 62

  Fly    74 A----DYNSVIDGAKVIETAIKAFGRVDILVNNAGI-LRDRSLVKTSEQDWNLVNDVHLKGSFKC 133
            |    ...|..|..|:::..::.||:::|||||.|| .....:::.|:|.|:.:.:|::|..|:.
 Worm    63 AGIAGHIASTDDQKKLVDFTLQKFGKINILVNNHGINPAFGHILEVSDQVWDKLFEVNVKAGFQM 127

  Fly   134 TQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVP- 197
            |:...|::.|:..|.||..:|.|......|...|...|..|:||...:|:..|::|:..|.|.| 
 Worm   128 TKLVHPHIAKEGGGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALAMGLAKDNIRVNGIAPG 192

  Fly   198 ---------------TAASRMTEGILPDILFNEL-KPKLIAPVVAYLCHESCEDNGSYI 240
                           .|...:|:  :.:|....| .|...|..||||    ..|:.|||
 Worm   193 VIKTKMSQVLWDGGEDAEKELTD--IQEIALGRLGVPDDCAGTVAYL----ASDDSSYI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 71/254 (28%)
PRK07791 11..248 CDD:236099 70/252 (28%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
dhrs-4NP_506230.1 SDR 9..260 CDD:330230 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.