DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfe2 and AT5G60335

DIOPT Version :10

Sequence 1:NP_573109.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001318847.1 Gene:AT5G60335 / 10723110 AraportID:AT5G60335 Length:166 Species:Arabidopsis thaliana


Alignment Length:109 Identity:31/109 - (28%)
Similarity:49/109 - (44%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 TSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKV 547
            :|||..|...:|.|.||||.||:.|..|||:..::||:.......|.:.|.|..   |::.:..:
plant    39 SSEDIKAYAEVSHDWNPLHFDPESARKAGFENRLVHGMLVSSMFPRIISAHFPG---AVYVSQSL 100

  Fly   548 RFSGPVIPG-------QTLRVDLWKQGTRINFRTVVVETGKEVI 584
            .|..||..|       |.:.:...|....:.|.|...:...|::
plant   101 HFRSPVYIGDEILGLVQAIALRETKNKYIVKFSTKCFKNHNELV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfe2NP_573109.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611
PLN02864 315..598 CDD:178455 31/109 (28%)
AT5G60335NP_001318847.1 R_hydratase 26..154 CDD:239533 31/109 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.