DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and TBL1Y

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_016885575.1 Gene:TBL1Y / 90665 HGNCID:18502 Length:577 Species:Homo sapiens


Alignment Length:467 Identity:103/467 - (22%)
Similarity:160/467 - (34%) Gaps:159/467 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSI--DCVRFAYKDNFVY 76
            ::.|:|.|..........:|.:|..|....:|.:.:|    |..|..:.:  .|:|....|  |.
Human   175 LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNEN----SNGGSTQLVLRHCIREGGHD--VP 233

  Fly    77 SADDI------------------GIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSND 123
            |..|:                  |..|.|..|. .:.|||..|...:..|.:|..|.||:|...|
Human   234 SNKDVTSLDWNSDGTLLAMGSYDGFARIWTENG-NLASTLGQHKGPIFALKWNKKGNYVLSAGVD 297

  Fly   124 TTVRLW-------------------DVQNENN----------CIKVCR-----------GHMSHV 148
            .|..:|                   ||..:||          ||.|||           ||.:.|
Human   298 KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTNEV 362

  Fly   149 NSVKFSPDGLWIASAGLEGSILIWDIRK----------SKQIMEFIADP--PVTAITCVQFHP-F 200
            |::|:.|.|:.:||...:.::.||.:::          ||:|......|  |.|:      :| .
Human   363 NAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATS------NPNS 421

  Fly   201 EFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWEPDRE 265
            ..:||:...|.||.::|:| |.:.:.|...:.:.:..:.||.:|:.|..||              
Human   422 SIMLASASFDSTVRLWDVE-QGVCTHTLMKHQEPVYSVAFSPDGKYLASGS-------------- 471

  Fly   266 LDHIKSTWSSLADMKVVNNKLICGCHEIDTVSINTISLDRVIPFYQPPNSLPNFKHNSTNRKSFT 330
            .|.....|                         ||.| ..::..||                   
Human   472 FDKYVHIW-------------------------NTQS-GSLVHSYQ------------------- 491

  Fly   331 RGNQKFRLSVGGAKPAQVQEEHEGDKSGLSSP--NYSLEVVNEAVLESAETSPMSSLPPVHL-AS 392
                    ..||.  .:|.....|||.|.|:.  :.||.|....||.|......:.:..||| ||
Human   492 --------GTGGI--FEVCWNARGDKVGASASDGSDSLAVWISNVLASEPEEEKTKIVSVHLFAS 546

  Fly   393 MAGSSADLAPHH 404
            ::.:|.:....|
Human   547 LSSASENALSTH 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 82/388 (21%)
WD40 14..260 CDD:238121 75/318 (24%)
WD40 repeat 22..58 CDD:293791 6/35 (17%)
WD40 repeat 63..99 CDD:293791 12/55 (22%)
WD40 repeat 106..142 CDD:293791 16/64 (25%)
WD40 repeat 148..184 CDD:293791 12/45 (27%)
WD40 repeat 192..228 CDD:293791 9/36 (25%)
WD40 repeat 285..310 CDD:293791 3/24 (13%)
TBL1YXP_016885575.1 LisH 6..32 CDD:312123
WD40 174..480 CDD:238121 77/357 (22%)
WD40 repeat 182..229 CDD:293791 10/50 (20%)
WD40 repeat 239..274 CDD:293791 7/35 (20%)
WD40 repeat 279..356 CDD:293791 18/76 (24%)
WD40 repeat 363..398 CDD:293791 8/34 (24%)
WD40 repeat 404..449 CDD:293791 14/51 (27%)
WD40 repeat 455..493 CDD:293791 13/104 (13%)
WD40 repeat 496..522 CDD:293791 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.