DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and CIA1

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_010553.3 Gene:CIA1 / 851860 SGDID:S000002675 Length:330 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:65/299 - (21%)
Similarity:112/299 - (37%) Gaps:85/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISKIYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKD 72
            |:.|..:|.:..::.|.|..:  .:|.||..||.:.|.::                         
Yeast     4 INLIKSLKLYKEKIWSFDFSQ--GILATGSTDRKIKLVSV------------------------- 41

  Fly    73 NFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLW------DV 131
                ..||..:|...|..:         |.|::|::.:.|....:.:||.|:||.:|      |.
Yeast    42 ----KYDDFTLIDVLDETA---------HKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADR 93

  Fly   132 QNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIA--DPPVTAITC 194
            ..|.:.:.:..||.:.|..|.:|.||.::|:...:.|:.||:..:|.:..|.|:  ......:..
Yeast    94 TFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKH 158

  Fly   195 VQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIG 259
            |.:||.|.|||:...|.||.|:.                     .:.|:.||:.|.:.       
Yeast   159 VIWHPSEALLASSSYDDTVRIWK---------------------DYDDDWECVAVLNG------- 195

  Fly   260 WEPDRELDHIKSTWSSLADMKVVNNKLICGCHEIDTVSI 298
                    |..:.|||..| |......:|...:..||.:
Yeast   196 --------HEGTVWSSDFD-KTEGVFRLCSGSDDSTVRV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 65/299 (22%)
WD40 14..260 CDD:238121 54/253 (21%)
WD40 repeat 22..58 CDD:293791 8/35 (23%)
WD40 repeat 63..99 CDD:293791 4/35 (11%)
WD40 repeat 106..142 CDD:293791 10/41 (24%)
WD40 repeat 148..184 CDD:293791 11/35 (31%)
WD40 repeat 192..228 CDD:293791 11/35 (31%)
WD40 repeat 285..310 CDD:293791 3/14 (21%)
CIA1NP_010553.3 WD40 6..325 CDD:238121 64/297 (22%)
WD40 repeat 17..54 CDD:293791 11/67 (16%)
WD40 repeat 63..105 CDD:293791 9/41 (22%)
WD40 repeat 111..151 CDD:293791 11/39 (28%)
WD40 repeat 156..194 CDD:293791 15/58 (26%)
WD40 repeat 201..246 CDD:293791 8/26 (31%)
WD40 repeat 253..289 CDD:293791
WD40 repeat 298..326 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.