DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and WDR75

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_115544.1 Gene:WDR75 / 84128 HGNCID:25725 Length:830 Species:Homo sapiens


Alignment Length:420 Identity:83/420 - (19%)
Similarity:142/420 - (33%) Gaps:142/420 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDNFVY--SADDIGIIRRWDLNSQKIYST--- 97
            |:.|:.:...|.:|     ....|::    |:....:::  |.|.:           |:|||   
Human     3 EEENIRVVRCGGSE-----LNFRRAV----FSADSKYIFCVSGDFV-----------KVYSTVTE 47

  Fly    98 -----LNGHMKSVRTLDFNPSGE-YVVSGSNDTTVRLWDVQNENNCIKV----CRGHMSHV---- 148
                 |:||...|..:..||:.. .:.|.|.|.|::||| ..:...||.    |:.|....    
Human    48 ECVHILHGHRNLVTGIQLNPNNHLQLYSCSLDGTIKLWD-YIDGILIKTFIVGCKLHALFTLAQA 111

  Fly   149 -NSV-----KFSPDGLWIASAGL-EGSILIWDIRKSKQIMEFIADPP-----------VTAI--- 192
             :||     |..||...:.|..| :.|....:.::...::::|...|           |.|:   
Human   112 EDSVFVIVNKEKPDIFQLVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREF 176

  Fly   193 ------------------------------TCVQFHPFEFLLAAGRVDGTV----SIYDLEHQQL 223
                                          |||..||.|..:|:|.:||.:    :.||  .::.
Human   177 YLSVYFFKKKTTSRFTLSSSRNKKHAKNNFTCVACHPTEDCIASGHMDGKIRLWRNFYD--DKKY 239

  Fly   224 VSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIGW----EPDRE--------LDHIKSTWSSL 276
            .....|::...:..:.||..|..|..|....: ::.|    |.::|        ::||  :.|..
Human   240 TYTCLHWHHDMVMDLAFSVTGTSLLSGGRESV-LVEWRDATEKNKEFLPRLGATIEHI--SVSPA 301

  Fly   277 ADMKVVNNKLICGCHEIDTVSI--NTISLDRVIPFYQPPNSL-------PNFKHNSTNRK----- 327
            .|       |.|..|..:.:.|  ..:....||.......|:       |..|....|.|     
Human   302 GD-------LFCTSHSDNKIIIIHRNLEASAVIQGLVKDRSIFTGLMIDPRTKALVLNGKPGHLQ 359

  Fly   328 --SFTRGNQKFRLSVGGAKPAQVQEEHEGD 355
              |.....|.:.|.:       :|:|:..|
Human   360 FYSLQSDKQLYNLDI-------IQQEYIND 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 78/393 (20%)
WD40 14..260 CDD:238121 59/295 (20%)
WD40 repeat 22..58 CDD:293791 4/19 (21%)
WD40 repeat 63..99 CDD:293791 7/45 (16%)
WD40 repeat 106..142 CDD:293791 11/40 (28%)
WD40 repeat 148..184 CDD:293791 8/46 (17%)
WD40 repeat 192..228 CDD:293791 12/72 (17%)
WD40 repeat 285..310 CDD:293791 6/26 (23%)
WDR75NP_115544.1 WD 1 4..43 8/58 (14%)
WD40 20..316 CDD:295369 65/323 (20%)
WD40 <24..320 CDD:225201 65/319 (20%)
WD 2 47..86 11/38 (29%)
WD40 repeat 61..99 CDD:293791 11/38 (29%)
WD 3 90..131 9/40 (23%)
WD 4 145..184 4/38 (11%)
WD40 repeat 159..194 CDD:293791 2/34 (6%)
WD40 177..603 CDD:225201 42/225 (19%)
WD 5 193..231 10/37 (27%)
WD40 repeat 206..242 CDD:293791 12/37 (32%)
WD40 207..535 CDD:295369 42/195 (22%)
WD 6 237..276 6/39 (15%)
WD40 repeat 251..289 CDD:293791 8/38 (21%)
WD 7 279..318 10/47 (21%)
WD40 repeat 293..317 CDD:293791 7/32 (22%)
WD 8 324..362 7/37 (19%)
WD 9 376..423 3/7 (43%)
WD40 repeat 380..432 CDD:293791 1/3 (33%)
WD 10 430..474
WD40 repeat 445..494 CDD:293791
WD 11 487..525
WD40 repeat 501..524 CDD:293791
WD 12 529..569
WD 13 574..611
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.