DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and PEX7

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_174220.1 Gene:PEX7 / 839800 AraportID:AT1G29260 Length:317 Species:Arabidopsis thaliana


Alignment Length:224 Identity:58/224 - (25%)
Similarity:95/224 - (42%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYST-----------LNGHMKSVRTLDFNPS-G 114
            |.|.....|...:..|.|.:.|....| .|.|||.|           ...|.:.|:::|:||: .
plant    56 SYDTADAVYDVCWSESHDSVLIAAIGD-GSVKIYDTALPPPSNPIRSFQEHAREVQSVDYNPTRR 119

  Fly   115 EYVVSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSP-DGLWIASAGLEGSILIWDIRKSK 178
            :..::.|.|.||:||.:....: ::..:.|...|....::| .|...|||..:.::.|||:|   
plant   120 DSFLTSSWDDTVKLWAMDRPAS-VRTFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDVR--- 180

  Fly   179 QIMEFIADPPVTAITCVQFHPFEFL-----------LAAGRVDGTVSIYDLEHQQLVSQTTHFYG 232
                   :|..|.|  :..|.||.|           ||...||.||.::|:...::.....:.:|
plant   181 -------EPGSTMI--IPAHDFEILSCDWNKYDDCILATSSVDKTVKVWDVRSYRVPLAVLNGHG 236

  Fly   233 QAIRCITFSDNGECLFVGSSSGISVIGWE 261
            .|:|.:.||.:...|....|..:||..|:
plant   237 YAVRKVKFSPHRRSLIASCSYDMSVCLWD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 58/224 (26%)
WD40 14..260 CDD:238121 57/221 (26%)
WD40 repeat 22..58 CDD:293791
WD40 repeat 63..99 CDD:293791 11/46 (24%)
WD40 repeat 106..142 CDD:293791 9/36 (25%)
WD40 repeat 148..184 CDD:293791 10/36 (28%)
WD40 repeat 192..228 CDD:293791 12/46 (26%)
WD40 repeat 285..310 CDD:293791
PEX7NP_174220.1 WD40 11..309 CDD:421866 58/224 (26%)
WD40 repeat 11..59 CDD:293791 1/2 (50%)
WD40 repeat 63..104 CDD:293791 10/41 (24%)
WD40 repeat 110..147 CDD:293791 9/37 (24%)
WD40 repeat 152..189 CDD:293791 13/48 (27%)
WD40 repeat 196..233 CDD:293791 8/36 (22%)
WD40 repeat 239..277 CDD:293791 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.