DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and AT2G47790

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_566111.1 Gene:AT2G47790 / 819391 AraportID:AT2G47790 Length:392 Species:Arabidopsis thaliana


Alignment Length:225 Identity:55/225 - (24%)
Similarity:91/225 - (40%) Gaps:56/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NSQKIYSTL--------NGHMKSVRTLDFN----PSGEYVVSGSNDTTVRLWDVQNENNCIKVCR 142
            |:.|:||.:        .||..:|..:.|:    .|...:.|.|:|.|:|.||.::.....::..
plant    63 NTVKLYSPVTGQYYGECKGHSDTVNQIAFSSDSAASPHVLHSCSSDGTIRSWDTRSFQQVSRIDT 127

  Fly   143 GHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQI--MEFIADPPVTAITCVQFHPFEFLLA 205
            |:...:.|..:......:.:.|.:..:|:||.|.|||:  :|......||.:..|...|.:.|.|
plant   128 GNDQEIFSFSYGGAADNLLAGGCKEQVLLWDWRNSKQVACLEESHMDDVTQVHFVPNKPNKLLSA 192

  Fly   206 AGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRCITFSDNGECLF-VGSSSG-ISVIGWEPDRELDH 268
            :  |||.:.:::.|..                |...|:.|.:. ||:|.| |..:|       |.
plant   193 S--VDGLICLFNTEGD----------------INDDDHLESVINVGTSIGKIGFLG-------DG 232

  Fly   269 IKSTWSSLADMKVVNNKLICGCHEIDTVSI 298
            .|..|              |..| |:|:||
plant   233 YKKLW--------------CLTH-IETLSI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 55/225 (24%)
WD40 14..260 CDD:238121 45/185 (24%)
WD40 repeat 22..58 CDD:293791
WD40 repeat 63..99 CDD:293791 4/16 (25%)
WD40 repeat 106..142 CDD:293791 9/39 (23%)
WD40 repeat 148..184 CDD:293791 10/37 (27%)
WD40 repeat 192..228 CDD:293791 8/35 (23%)
WD40 repeat 285..310 CDD:293791 6/14 (43%)
AT2G47790NP_566111.1 WD40 <41..275 CDD:225201 55/225 (24%)
WD40 repeat 43..81 CDD:293791 4/17 (24%)
WD40 repeat 87..128 CDD:293791 9/40 (23%)
WD40 repeat 133..169 CDD:293791 9/35 (26%)
WD40 repeat 177..210 CDD:293791 10/50 (20%)
WD40 repeat 217..261 CDD:293791 15/53 (28%)
WD40 repeat 269..321 CDD:293791
WD40 repeat 328..358 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.