DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and ARPC1A

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001189645.1 Gene:ARPC1A / 817641 AraportID:AT2G30910 Length:378 Species:Arabidopsis thaliana


Alignment Length:309 Identity:59/309 - (19%)
Similarity:104/309 - (33%) Gaps:120/309 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLT--GHNRSIDCVRFAYKD 72
            :::.::.||..|:.:|.......:||...|||..:|::...|...:|.  ..||:..||:::.|:
plant    47 RLHVLQKHDQIVSGIDWSSKSNKIVTVSHDRNSYVWSLEGAEWVPTLVILRLNRAALCVQWSPKE 111

  Fly    73 NFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLWDVQNENNC 137
            |                                         ::.| ||...||.:...:.||| 
plant   112 N-----------------------------------------KFAV-GSGAKTVCICYYEQENN- 133

  Fly   138 IKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTAITCVQFHPFEF 202
                                .|::..          |||..:          :::|.|.:||...
plant   134 --------------------WWVSKL----------IRKRHE----------SSVTSVAWHPNNV 158

  Fly   203 LLAAGRVDGTVSIY-------DLEHQQLVSQTTHFYGQAIR----------CITFSDNGECL-FV 249
            |||....||...::       |.:..:..|.....:|:.|.          .:.:|.:|..| :|
plant   159 LLATTSTDGKCRVFSTFIKGVDTKDSKAGSPAETKFGEQILQLDLSYSWAFGVKWSPSGNTLAYV 223

  Fly   250 GSSSGI---SVIGWEP------DRELDHIKSTWSSLADMKVVNNKLICG 289
            |.||.|   ..:|..|      .|:|        .|.|:..::.|::.|
plant   224 GHSSMIYFVDDVGPSPLAQSVAFRDL--------PLRDVLFISEKMVIG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 59/309 (19%)
WD40 14..260 CDD:238121 51/268 (19%)
WD40 repeat 22..58 CDD:293791 9/37 (24%)
WD40 repeat 63..99 CDD:293791 4/35 (11%)
WD40 repeat 106..142 CDD:293791 8/35 (23%)
WD40 repeat 148..184 CDD:293791 4/35 (11%)
WD40 repeat 192..228 CDD:293791 11/42 (26%)
WD40 repeat 285..310 CDD:293791 2/5 (40%)
ARPC1ANP_001189645.1 WD40 8..371 CDD:225201 59/309 (19%)
WD40 repeat 13..53 CDD:293791 0/5 (0%)
WD40 48..>282 CDD:295369 59/308 (19%)
WD40 repeat 59..96 CDD:293791 9/36 (25%)
WD40 repeat 102..141 CDD:293791 13/111 (12%)
WD40 repeat 149..194 CDD:293791 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.