DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and emb1345

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_565615.1 Gene:emb1345 / 817147 AraportID:AT2G26060 Length:352 Species:Arabidopsis thaliana


Alignment Length:483 Identity:93/483 - (19%)
Similarity:170/483 - (35%) Gaps:178/483 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDLGETGRVLV-----TGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYK-DNFVYSADDIG 82
            :||.|....||     .|..||   :|::..|    .::.|...:..:..:.. ||.|...:...
plant     1 MDLMEKNLELVEIQKLEGHTDR---VWSVAWN----PVSSHADGVSPILASCSGDNTVRIWEQSS 58

  Fly    83 IIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRLW-DVQNENNCIKVCRGHMS 146
            :.|.|...: .:..|   |.::||:..::|||:.:.:.|.|.|..:| :..:|..||....||.:
plant    59 LSRSWTCKT-VLEET---HTRTVRSCAWSPSGQLLATASFDGTTGIWKNYGSEFECISTLEGHEN 119

  Fly   147 HVNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEFIADPPVTA----ITCVQFHPFEFLLAAG 207
            .|.||.::..|..:|:...:.|:.||::.:..   |:.....:|.    :..||:||...:|.:.
plant   120 EVKSVSWNASGSCLATCSRDKSVWIWEVLEGN---EYDCAAVLTGHTQDVKMVQWHPTMDVLFSC 181

  Fly   208 RVDGTVSIY-----DLEHQQLVSQTTHFYGQAIRCITFSDNGECLFVGSSSGISVIGWEPDRELD 267
            ..|.|:.::     |.|:            |.::.:..|:||                       
plant   182 SYDNTIKVWWSEDDDGEY------------QCVQTLGESNNG----------------------- 211

  Fly   268 HIKSTWSSLADMKVVNNKLICGCHEIDTVSINTISLDRVIPFYQPPNSLPNFKHNSTNRKSFTRG 332
            |..:.||                     :|.|.                                
plant   212 HSSTVWS---------------------ISFNA-------------------------------- 223

  Fly   333 NQKFRLSVGGAKPAQVQEEHEGDKSGLSSPNYSLEV--VNEAVLESAETSPMSSLPPVHLASMAG 395
                                .|||....|.:.:|::  .:.|.::|.|    ...|.:||.:::|
plant   224 --------------------AGDKMVTCSDDLTLKIWGTDIAKMQSGE----EYAPWIHLCTLSG 264

  Fly   396 ------SSADLAPHHVVYGGAIDSALRQGKYSRVPDNMASYGSSYGAIDTRLMSLNEPSSLHKPD 454
                  .||..:...::..||.|:|:|.                  .:|::..|::.||      
plant   265 YHDRTIYSAHWSRDDIIASGAGDNAIRL------------------FVDSKHDSVDGPS------ 305

  Fly   455 IYNLYPLDKNE--EADVQQLEFNLNDSN 480
             |||. |.||:  |.||..::::..:.|
plant   306 -YNLL-LKKNKAHENDVNSVQWSPGEGN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 60/321 (19%)
WD40 14..260 CDD:238121 55/251 (22%)
WD40 repeat 22..58 CDD:293791 10/38 (26%)
WD40 repeat 63..99 CDD:293791 6/36 (17%)
WD40 repeat 106..142 CDD:293791 11/36 (31%)
WD40 repeat 148..184 CDD:293791 9/35 (26%)
WD40 repeat 192..228 CDD:293791 9/40 (23%)
WD40 repeat 285..310 CDD:293791 2/24 (8%)
emb1345NP_565615.1 WD40 12..347 CDD:238121 88/472 (19%)
WD40 repeat 23..71 CDD:293791 8/52 (15%)
WD40 repeat 78..116 CDD:293791 11/37 (30%)
WD40 repeat 121..160 CDD:293791 9/41 (22%)
WD40 repeat 167..206 CDD:293791 10/50 (20%)
WD40 repeat 216..263 CDD:293791 15/123 (12%)
WD40 repeat 270..313 CDD:293791 15/68 (22%)
WD40 repeat 320..346 CDD:293791 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.