| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_078989.1 | Gene: | KATNBL1 / 79768 | HGNCID: | 26199 | Length: | 304 | Species: | Homo sapiens |
| Alignment Length: | 250 | Identity: | 44/250 - (17%) |
|---|---|---|---|
| Similarity: | 89/250 - (35%) | Gaps: | 75/250 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 569 HKLDDNMV-LKKSSSSNVVNKNKRPMGSAQSQFSKENNQQKNINVEIITKPPMRSRTTLDMRTSH 632
Fly 633 QAKTQEKQIH----------QQQPMNNRIIMDD----------------HD-------------- 657
Fly 658 ------------FDMLSRSHEAVLQELSNRQSSLDLLRHATRSH---DVLGALRQARSCGKSIFI 707
Fly 708 D----LLGAILEKPSSWNLDFCMFVLPEIYELLQSQHKFHFTRACDTLRIILSNF 758 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | 18/98 (18%) |
| WD40 | <4..330 | CDD:225201 | |||
| WD40 | 14..260 | CDD:238121 | |||
| WD40 repeat | 22..58 | CDD:293791 | |||
| WD40 repeat | 63..99 | CDD:293791 | |||
| WD40 repeat | 106..142 | CDD:293791 | |||
| WD40 repeat | 148..184 | CDD:293791 | |||
| WD40 repeat | 192..228 | CDD:293791 | |||
| WD40 repeat | 285..310 | CDD:293791 | |||
| KATNBL1 | NP_078989.1 | Nuclear localization signal 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00768 | 26..33 | 2/6 (33%) | |
| Nuclear localization signal 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00768 | 72..79 | 3/15 (20%) | |||
| Katanin_con80 | 153..296 | CDD:372820 | 18/98 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.960 | |||||