DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kat80 and Nup43

DIOPT Version :9

Sequence 1:NP_523363.2 Gene:kat80 / 32581 FlyBaseID:FBgn0040207 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_006227684.1 Gene:Nup43 / 683983 RGDID:1596513 Length:378 Species:Rattus norvegicus


Alignment Length:151 Identity:41/151 - (27%)
Similarity:72/151 - (47%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LVTGGEDRNVNLWAIGQNECFMSLTGHNRS-IDCVRFAYKDNFVYSADDIGIIRRWDLNSQ---- 92
            :||.|||..:||:.:...|...::...:.| :..|.|......| :.:.||.::.||...|    
  Rat   144 IVTVGEDGRINLFRVDHKEAVRTIDNADSSTLHAVTFLRTPEIV-TVNSIGQLKIWDFRQQGSEP 207

  Fly    93 -KIYSTLNGHMKSVRTLDFNPSGEYVV-SGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKF-- 153
             :|.| |.|....:..:|.:|..::|| :|..|..:.:|||:.....:.:.:.|.:.:..|.|  
  Rat   208 CQILS-LTGDRVPLHCVDRHPDQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHP 271

  Fly   154 -SPDGLWIASAGLEGSILIWD 173
             :||.|:..|.  :||:..||
  Rat   272 SNPDHLFTCSE--DGSLWHWD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kat80NP_523363.2 Katanin_con80 667..803 CDD:290636
WD40 <4..330 CDD:225201 41/151 (27%)
WD40 14..260 CDD:238121 41/151 (27%)
WD40 repeat 22..58 CDD:293791 8/24 (33%)
WD40 repeat 63..99 CDD:293791 10/40 (25%)
WD40 repeat 106..142 CDD:293791 9/36 (25%)
WD40 repeat 148..184 CDD:293791 10/29 (34%)
WD40 repeat 192..228 CDD:293791
WD40 repeat 285..310 CDD:293791
Nup43XP_006227684.1 WD40 73..>293 CDD:421866 41/151 (27%)
WD40 repeat 78..120 CDD:293791
WD40 repeat 125..168 CDD:293791 8/23 (35%)
WD40 repeat 175..212 CDD:293791 9/37 (24%)
WD40 repeat 220..258 CDD:293791 9/37 (24%)
WD40 repeat 266..303 CDD:293791 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.