| Sequence 1: | NP_523363.2 | Gene: | kat80 / 32581 | FlyBaseID: | FBgn0040207 | Length: | 819 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571683.1 | Gene: | apaf1 / 58131 | ZFINID: | ZDB-GENE-000616-4 | Length: | 1261 | Species: | Danio rerio |
| Alignment Length: | 378 | Identity: | 80/378 - (21%) |
|---|---|---|---|
| Similarity: | 148/378 - (39%) | Gaps: | 81/378 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 KIYDIKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQ---------------NECFMSLTGH 59
Fly 60 NRSIDCVRFAYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDT 124
Fly 125 TVRLWDVQ--NENNCIKVCRGHMSHVNSVK-------FSPDGLWIASAGLEGSILIWDIRKSKQI 180
Fly 181 MEFIADPPVTAITCVQF-H--PFEFLLAAGRVDGTVSIYDLEHQQLVSQTT-HFYGQAIRCITFS 241
Fly 242 DNGECLFVGSSSGISVIGWEPD-----------RELDHIK---------------------STWS 274
Fly 275 SLADMKVVNNKLICGCHEIDTVSINTISLDRVIPFYQPPNSLPNFK---HNST 324 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kat80 | NP_523363.2 | Katanin_con80 | 667..803 | CDD:290636 | |
| WD40 | <4..330 | CDD:225201 | 80/378 (21%) | ||
| WD40 | 14..260 | CDD:238121 | 63/273 (23%) | ||
| WD40 repeat | 22..58 | CDD:293791 | 9/50 (18%) | ||
| WD40 repeat | 63..99 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 106..142 | CDD:293791 | 11/37 (30%) | ||
| WD40 repeat | 148..184 | CDD:293791 | 8/42 (19%) | ||
| WD40 repeat | 192..228 | CDD:293791 | 10/38 (26%) | ||
| WD40 repeat | 285..310 | CDD:293791 | 4/24 (17%) | ||
| apaf1 | NP_571683.1 | DD | 7..92 | CDD:301326 | |
| NB-ARC | 132..411 | CDD:279299 | |||
| P-loop_NTPase | 150..297 | CDD:304359 | |||
| WD 1 | 615..654 | 1/2 (50%) | |||
| WD40 | 616..912 | CDD:238121 | 64/278 (23%) | ||
| WD40 repeat | 625..657 | CDD:293791 | 1/5 (20%) | ||
| WD40 | 641..1042 | CDD:225201 | 80/378 (21%) | ||
| WD 2 | 657..696 | 10/38 (26%) | |||
| WD40 repeat | 663..699 | CDD:293791 | 7/35 (20%) | ||
| WD 3 | 700..743 | 11/52 (21%) | |||
| WD40 repeat | 705..745 | CDD:293791 | 12/49 (24%) | ||
| WD 4 | 746..785 | 13/38 (34%) | |||
| WD40 repeat | 752..796 | CDD:293791 | 11/43 (26%) | ||
| WD 5 | 798..836 | 8/38 (21%) | |||
| WD40 repeat | 803..841 | CDD:293791 | 7/42 (17%) | ||
| WD 6 | 840..879 | 10/38 (26%) | |||
| WD40 | 851..1256 | CDD:225201 | 31/163 (19%) | ||
| WD40 | 877..1212 | CDD:238121 | 24/137 (18%) | ||
| WD 7 | 882..921 | 11/41 (27%) | |||
| WD40 repeat | 887..911 | CDD:293791 | 7/24 (29%) | ||
| WD40 repeat | 960..1005 | CDD:293791 | 7/44 (16%) | ||
| WD 8 | 964..1003 | 6/38 (16%) | |||
| WD 9 | 1006..1045 | 2/5 (40%) | |||
| WD40 repeat | 1011..1046 | CDD:293791 | 80/378 (21%) | ||
| WD 10 | 1047..1088 | ||||
| WD 11 | 1091..1130 | ||||
| WD40 repeat | 1096..1132 | CDD:293791 | |||
| WD 12 | 1133..1172 | ||||
| WD40 repeat | 1138..1162 | CDD:293791 | |||
| WD 13 | 1184..1223 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||